PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00014.1.g05380.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 393aa    MW: 42450.7 Da    PI: 8.824
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00014.1.g05380.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-31254309156
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                     k r++W+peLH++Fv a+++LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Zjn_sc00014.1.g05380.1.sm.mkhc 254 KSRRCWSPELHRQFVAALNKLGGPQVATPKQIRELMKVEGLTNDEVKSHLQKYRLH 309
                                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.021251311IPR017930Myb domain
SuperFamilySSF466893.34E-17252312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28252312IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-26254309IPR006447Myb domain, plants
PfamPF002492.8E-7256307IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MGLDVGEIGM GADLSLDLRH FASKAMKQTR SAQASDMDTY IRRLEEERGK IEVFRRELPI  60
CARLLADAID VMKEEAEKEK KNDHKEEEEE DGAAGDKSKW MSTAQLWTSG SGREAAEPER  120
VCGWAKAPSF VRSQKQESDK GRSSSEQKSF SVGALTLFNA VASGAPSSRQ RPRLRNNDDK  180
AADVEMPDLS LLSPPPITSV PAAAADKSRR LVVGLATAAA RACGMVPSAG GPTLCLPPQV  240
KQTTPQQQQQ QARKSRRCWS PELHRQFVAA LNKLGGPQVA TPKQIRELMK VEGLTNDEVK  300
SHLQKYRLHT RRTPSGPAVV SQPIVLVGGL WIPHQEHSQS GTQSQSSGSP QGPLHFSPAS  360
GVATASCEEE ASAAGPRSAT AGNDQQGILH RQS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459272.11e-126hypothetical protein SORBIDRAFT_02g001600
TrEMBLA0A0A9H2111e-130A0A0A9H211_ARUDO; Uncharacterized protein
STRINGSb02g001600.11e-126(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-34G2-like family protein